-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human COP1 (NP_071902.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human COP1 (NP_071902.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07968A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COP1 |
| Target Synonyms | FAP78; RFWD2; CFAP78; RNF200; COP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human COP1 (NP_071902.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV | Uniprot ID | Q8NHY2 |
Uniprot Id
Q8NHY2
Target Species
Human
Target Name
COP1
Target Full Name
E3 ubiquitin-protein ligase COP1
Target Function
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Ubiquitinates MTA1 leading to its proteasomal degradation. Upon binding to TRIB1, ubiquitinates CEBPA, which lacks a canonical COP1-binding motif.
Target Subcellular Location
Nucleus speckle. Cytoplasm. Note=In the nucleus, it forms nuclear speckles.
Target Protein Families
COP1 family
Target Tissue Specificity
Ubiquitously expressed at low level. Expressed at higher level in testis, placenta, skeletal muscle and heart.
Target Synonyms
COP1; RFWD2; RNF200; E3 ubiquitin-protein ligase COP1; Constitutive photomorphogenesis protein 1 homolog; hCOP1; RING finger and WD repeat domain protein 2; RING finger protein 200; RING-type E3 ubiquitin transferase RFWD2
Target Background
Enables ubiquitin protein ligase activity. Involved in positive regulation of proteasomal ubiquitin-dependent protein catabolic process; proteasome-mediated ubiquitin-dependent protein catabolic process; and response to ionizing radiation. Part of Cul4A-RING E3 ubiquitin ligase complex.
Notification