-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human COPA (NP_001091868.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human COPA (NP_001091868.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06511A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COPA |
| Target Synonyms | AILJK; HEP-COP; alpha-COP; COPA | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human COPA (NP_001091868.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFKLALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHF | Uniprot ID | P53621 |
Uniprot Id
P53621
Target Species
Human
Target Name
COPA
Target Full Name
Coatomer subunit alpha
Target Function
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.; Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor
Target Involvement
Autoimmune interstitial lung, joint, and kidney disease (AILJK)
Target Subcellular Location
Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle, COPI-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side.; [Xenin]: Secreted.
Target Tissue Specificity
Uniformly expressed in a wide range of adult and fetal tissues. Xenin is found in gastric, duodenal and jejunal mucosa. Circulates in the blood. Seems to be confined to specific endocrine cells.
Target Synonyms
Alpha coat protein; Alpha COP; Alpha COPI; Alpha-coat protein; Alpha-COP; AlphaCOP; Coatomer protein complex subunit alpha; Coatomer subunit alpha; COP A; COP I alpha; copA; COPA_HUMAN; COPI alpha; FLJ26320; HEP COP; HEP-COP; HEPCOP; Proxenin; Xenin; Xenopsin-related peptide
Notification