-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COPS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-423 of human COPS3 (Q9UNS2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against COPS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-423 of human COPS3 (Q9UNS2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14387A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COPS3 |
| Target Synonyms | CSN3; SGN3; COPS3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, Mouse brain, Mouse testis, RD | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 320-423 of human COPS3 (Q9UNS2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS | Uniprot ID | Q9UNS2 |
Uniprot Id
Q9UNS2
Target Species
Human
Target Name
COPS3
Target Full Name
COP9 signalosome complex subunit 3
Target Function
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
CSN3 family
Target Tissue Specificity
Widely expressed. Expressed at high level in heart and skeletal muscle.
Target Synonyms
Constitutive photomorphogenic homolog subunit 3; COP 9 (constitutive photomorphogenic) subunit 3; COP 9 complex homolog subunit 3; COP 9 complex S3; COP 9 complex subunit 3; COP 9 constitutive photomorphogenic homolog subunit 3; COP 9 homolog; COP 9 signalosome complex subunit 3; COP 9 signalosome subunit 3; COP 9 subunit 3; COP9 (constitutive photomorphogenic) subunit 3; COP9 complex homolog subunit 3; COP9 complex S3; COP9 complex subunit 3; COP9 constitutive photomorphogenic homolog subunit 3; COP9 homolog; COP9 signalosome complex subunit 3; COP9 signalosome subunit 3; COP9 subunit 3; COPS 3; cops3; CSN 3; CSN3; CSN3_HUMAN; JAB 1 containing signalosome subunit 3; JAB1 containing signalosome subunit 3; JAB1-containing signalosome subunit 3; SGN 3; SGN3; Signalosome subunit 3
Target Background
The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Several transcript variants encoding different isoforms have been found for this gene.
Notification