-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COPZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human COPZ1 (NP_057141.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against COPZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human COPZ1 (NP_057141.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02202A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COPZ1 |
| Target Synonyms | COPZ; CGI-120; HSPC181; zeta-COP; zeta1-COP; COPZ1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HT-29, LO2, Mouse spleen, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human COPZ1 (NP_057141.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR | Uniprot ID | P61923 |
Uniprot Id
P61923
Target Species
Human
Target Name
COPZ1
Target Full Name
Coatomer subunit zeta-1
Target Function
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.
Target Subcellular Location
Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle, COPI-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Adaptor complexes small subunit family
Target Synonyms
COPZ1; COPZ; CGI-120; HSPC181Coatomer subunit zeta-1; Zeta-1-coat protein; Zeta-1 COP
Target Background
This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants.
Notification