-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CORO1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 375-474 of human CORO1C (NP_055140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CORO1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 375-474 of human CORO1C (NP_055140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03930A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CORO1C |
| Target Synonyms | HCRNN4; CORO1C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 375-474 of human CORO1C (NP_055140.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA | Uniprot ID | Q9ULV4 |
Uniprot Id
Q9ULV4
Target Species
Human
Target Name
CORO1C
Target Full Name
Coronin-1C
Target Function
Plays a role in directed cell migration by regulating the activation and subcellular location of RAC1. Increases the presence of activated RAC1 at the leading edge of migrating cells. Required for normal organization of the cytoskeleton, including the actin cytoskeleton, microtubules and the vimentin intermediate filaments. Plays a role in endoplasmic reticulum-associated endosome fission: localizes to endosome membrane tubules and promotes recruitment of TMCC1, leading to recruitment of the endoplasmic reticulum to endosome tubules for fission. Endosome membrane fission of early and late endosomes is essential to separate regions destined for lysosomal degradation from carriers to be recycled to the plasma membrane. Required for normal cell proliferation, cell migration, and normal formation of lamellipodia. Required for normal distribution of mitochondria within cells.; Involved in myogenic differentiation.
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, lamellipodium. Cell projection, ruffle membrane. Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Endosome membrane.; [Isoform 3]: Cell membrane, sarcolemma. Cytoplasm, myofibril, sarcomere. Cell junction, synapse. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, cell cortex.
Target Protein Families
WD repeat coronin family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
COR1C_HUMAN; CORO 1C; Coro1c; Coronin 1c ; Coronin actin binding protein 1C; Coronin-1C; Coronin-3; Coronin1c; Coronin3; CRNN 4; CRNN4; HCRNN 4; hCRNN4
Target Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Three transcript variants encoding two different isoforms have been found for this gene.
Notification