Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CORO2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 361-480 of human CORO2B (NP_006082.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CORO2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 361-480 of human CORO2B (NP_006082.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10452A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CORO2B |
| Target Synonyms | CLIPINC; CORO2B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Jurkat, Mouse eye, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 361-480 of human CORO2B (NP_006082.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVVVNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC | Uniprot ID | Q9UQ03 |
Uniprot Id
Q9UQ03
Target Species
Human
Target Name
CORO2B
Target Full Name
Coronin-2B
Target Function
May play a role in the reorganization of neuronal actin structure.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
WD repeat coronin family
Target Tissue Specificity
Expressed predominantly in brain.
Target Synonyms
Actin binding protein; Clipin-C; CLIPINC; COR2B_HUMAN; CORO2B; Coronin actin binding protein 2B; Coronin; Coronin-2B; Coronin-like protein C; Protein FC96
Target Background
Enables talin binding activity and vinculin binding activity. Acts upstream of or within several processes, including negative regulation of cell-substrate adhesion; regulation of actin cytoskeleton organization; and regulation of establishment of protein localization. Located in focal adhesion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
