-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cortactin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human Cortactin (NP_005222.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Cortactin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human Cortactin (NP_005222.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09646A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cortactin |
| Target Synonyms | EMS1; Cortactin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human Cortactin (NP_005222.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQ | Uniprot ID | Q14247 |
Uniprot Id
Q14247
Target Species
Human
Target Name
CTTN
Target Full Name
Src substrate cortactin
Target Function
Contributes to the organization of the actin cytoskeleton and cell shape. Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones. Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density. Plays a role in the invasiveness of cancer cells, and the formation of metastases. Plays a role in focal adhesion assembly and turnover. In complex with ABL1 and MYLK regulates cortical actin-based cytoskeletal rearrangement critical to sphingosine 1-phosphate (S1P)-mediated endothelial cell (EC) barrier enhancement. Plays a role in intracellular protein transport and endocytosis, and in modulating the levels of potassium channels present at the cell membrane. Plays a role in receptor-mediated endocytosis via clathrin-coated pits. Required for stabilization of KCNH1 channels at the cell membrane.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Cell projection, ruffle. Cell projection, dendrite. Cell projection. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, podosome. Cell junction. Cell junction, focal adhesion. Membrane, clathrin-coated pit. Cell projection, dendritic spine. Cytoplasm, cell cortex.
Target Synonyms
Amplaxin; CTTN; EMS 1; EMS1; FLJ34459; Mammary tumor and squamous cell carcinoma associated; Oncogene EMS1; p80/85 src substrate; Src substrate cortactin; SRC8_HUMAN
Target Background
This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.
Notification