-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COTL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human COTL1 (NP_066972.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against COTL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human COTL1 (NP_066972.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09741A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COTL1 |
| Target Synonyms | CLP; COTL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, Jurkat, Mouse lung, Mouse spleen, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human COTL1 (NP_066972.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE | Uniprot ID | Q14019 |
Uniprot Id
Q14019
Target Species
Human
Target Name
COTL1
Target Full Name
Coactosin-like protein
Target Function
Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Nucleus.
Target Protein Families
Actin-binding proteins ADF family, Coactosin subfamily
Target Tissue Specificity
Widely expressed with highest levels in placenta, lung, kidney and peripheral blood leukocytes and lower levels in brain, liver and pancreas.
Target Research Area
Signal Transduction
Target Synonyms
CLP; Coactosin like 1; Coactosin-like protein; COTL1; COTL1_HUMAN; FLJ43657; MGC19733
Target Background
This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes.
Notification