-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COUP-TFII/NR2F2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 5-100 of human COUP-TFII/NR2F2 (NP_066285.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against COUP-TFII/NR2F2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 5-100 of human COUP-TFII/NR2F2 (NP_066285.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-15551A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COUP-TFII/NR2F2 |
| Target Synonyms | ARP1; ARP-1; CHTD4; NF-E3; SRXX5; SVP40; COUPTF2; COUPTFB; TFCOUP2; COUPTFII; COUP-TFII/NR2F2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, NIH/3T3, 293T, MCF7, PC-12 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 5-100 of human COUP-TFII/NR2F2 (NP_066285.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCK | Uniprot ID | P24468 |
Uniprot Id
P24468
Target Species
Human
Target Name
NR2F2
Target Full Name
COUP transcription factor 2
Target Function
Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A. May be required to establish ovary identity during early gonad development.
Target Involvement
Congenital heart defects, multiple types, 4 (CHTD4)
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR2 subfamily
Target Tissue Specificity
Ubiquitous. Expressed in the stromal cells of developing fetal ovaries.
Target Synonyms
Apolipoprotein A-I regulatory protein 1; Apolipoprotein AI regulatory protein 1; ARP-1; ARP1; COT2_HUMAN; COUP TF2; COUP transcription factor 2; COUP transcription factor II; COUP-TF II; COUP-TF2; NR2F2; Nuclear receptor subfamily 2 group F member 2
Target Background
This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants.
Notification