-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COX10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human COX10 (NP_001294.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COX10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human COX10 (NP_001294.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02438A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COX10 |
| Target Synonyms | MC4DN3; COX10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse esophagus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human COX10 (NP_001294.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARL | Uniprot ID | Q12887 |
Uniprot Id
Q12887
Target Species
Human
Target Name
COX10
Target Full Name
Protoheme IX farnesyltransferase, mitochondrial
Target Function
Converts protoheme IX and farnesyl diphosphate to heme O.
Target Involvement
Mitochondrial complex IV deficiency (MT-C4D); Leigh syndrome (LS)
Target Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
UbiA prenyltransferase family
Target Synonyms
2410004F01Rik; AU042636; COX10; COX10_HUMAN; Cytochrome c oxidase assembly protein; Cytochrome c oxidase subunit X; Heme A farnesyltransferase; Heme O synthase; OTTMUSP00000006085; Protoheme IX farnesyltransferase; mitochondrial; Protoheme IX farnesyltransferase; mitochondrial precursor; RP23-78H18.1
Target Background
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes heme A:farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. This protein is predicted to contain 7-9 transmembrane domains localized in the mitochondrial inner membrane. A gene mutation, which results in the substitution of a lysine for an asparagine (N204K), is identified to be responsible for cytochrome c oxidase deficiency. In addition, this gene is disrupted in patients with CMT1A (Charcot-Marie-Tooth type 1A) duplication and with HNPP (hereditary neuropathy with liability to pressure palsies) deletion.
Notification