-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COX15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human COX15 (NP_510870.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against COX15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human COX15 (NP_510870.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05514A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COX15 |
| Target Synonyms | MC4DN6; CEMCOX2; COX15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, A-431, Jurkat, Mouse lung, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human COX15 (NP_510870.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHK | Uniprot ID | Q7KZN9 |
Uniprot Id
Q7KZN9
Target Species
Human
Target Name
COX15
Target Full Name
Heme A synthase COX15
Target Function
May be involved in the biosynthesis of heme A.
Target Involvement
Cardioencephalomyopathy, fatal infantile, due to cytochrome c oxidase deficiency 2 (CEMCOX2); Leigh syndrome (LS)
Target Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
COX15/CtaA family
Target Tissue Specificity
Predominantly found in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle, heart, and brain.
Target Synonyms
CEMCOX2; COX15; COX15 homolog; cytochrome c oxidase assembly protein; COX15; S. cerevisiae; homolog of; COX15_HUMAN; cytochrome c oxidase assembly homolog 15 (yeast); Cytochrome c oxidase assembly protein COX15 homolog; cytochrome c oxidase subunit 15
Target Background
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region.
Notification