-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COX7A2L was raised in Rabbit using the recombinant protein of human COX7A2L as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COX7A2L was raised in Rabbit using the recombinant protein of human COX7A2L as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08124A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COX7A2L |
| Target Synonyms | EB1; SCAF1; SCAFI; SIG81; COX7AR; COX7RP; [KD Validated] COX7A2L | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant protein of human COX7A2L. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK | Uniprot ID | O14548 |
Uniprot Id
O14548
Target Species
Human
Target Name
COX7A2L
Target Full Name
Cytochrome c oxidase subunit 7A2-like, mitochondrial
Target Function
Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex.
Target Subcellular Location
Mitochondrion inner membrane.
Target Protein Families
Cytochrome c oxidase VIIa family
Target Research Area
Signal Transduction
Target Synonyms
COX7a related protein; COX7a-related protein; COX7A2L; COX7AR; COX7R_HUMAN; COX7RP; Cytochrome c oxidase subunit 7A-related protein; cytochrome c oxidase subunit 7A-related protein; mitochondrial; Cytochrome c oxidase subunit 7A2 like; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa polypeptide 2 like; Cytochrome c oxidase subunit VIIa related protein; mitochondrial; Cytochrome c oxidase subunit VIIa-related protein; EB1; Estrogen receptor binding CpG island; mitochondrial; SIG81
Target Background
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene.
Notification