-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COX8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human COX8A (NP_004065.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COX8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human COX8A (NP_004065.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04143A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COX8A |
| Target Synonyms | COX; COX8; VIII; COX8L; COX8-2; VIII-L; MC4DN15; COX8A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human COX8A (NP_004065.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE | Uniprot ID | P10176 |
Uniprot Id
P10176
Target Species
Human
Target Name
COX8A
Target Full Name
Cytochrome c oxidase subunit 8A, mitochondrial
Target Function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
Cytochrome c oxidase VIII family
Target Tissue Specificity
Widely expressed.
Target Synonyms
COX; COX8; COX8-2; COX8A; COX8A_HUMAN; COX8L; Cytochrome c oxidase polypeptide VIII-liver/heart; Cytochrome c oxidase subunit 8-2; Cytochrome c oxidase subunit 8A (ubiquitous); Cytochrome c oxidase subunit 8A; Cytochrome c oxidase subunit 8A, mitochondrial; Cytochrome c oxidase subunit VIII; Cytochrome c oxidase subunit VIIIA (ubiquitous); mitochondrial; VIII; VIII-L
Target Background
The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits.
Notification