-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CPSF73 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 585-684 of human CPSF3 (Q9UKF6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CPSF73 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 585-684 of human CPSF3 (Q9UKF6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14420A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CPSF73 |
| Target Synonyms | CPSF73; NEDMHS; CPSF-73; NEDMHSN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, Mouse liver, Mouse uterus, Rat spleen, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 585-684 of human CPSF3 (Q9UKF6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH | Uniprot ID | Q9UKF6 |
Uniprot Id
Q9UKF6
Target Species
Human
Target Name
CPSF3
Target Full Name
Cleavage and polyadenylation specificity factor subunit 3
Target Function
Component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Has endonuclease activity, and functions as mRNA 3'-end-processing endonuclease. Also involved in the histone 3'-end pre-mRNA processing. U7 snRNP-dependent protein that induces both the 3'-endoribonucleolytic cleavage of histone pre-mRNAs and acts as a 5' to 3' exonuclease for degrading the subsequent downstream cleavage product (DCP) of mature histone mRNAs. Cleavage occurs after the 5'-ACCCA-3' sequence in the histone pre-mRNA leaving a 3'hydroxyl group on the upstream fragment containing the stem loop (SL) and 5' phosphate on the downstream cleavage product (DCP) starting with CU nucleotides. The U7-dependent 5' to 3' exonuclease activity is processive and degrades the DCP RNA substrate even after complete removal of the U7-binding site. Binds to the downstream cleavage product (DCP) of histone pre-mRNAs and the cleaved DCP RNA substrate in a U7 snRNP dependent manner. Required for entering/progressing through S-phase of the cell cycle. Required for the selective processing of microRNAs (miRNAs) during embryonic stem cell differentiation via its interaction with ISY1. Required for the biogenesis of all miRNAs from the pri-miR-17-92 primary transcript except miR-92a. Only required for the biogenesis of miR-290 and miR-96 from the pri-miR-290-295 and pri-miR-96-183 primary transcripts, respectively
Target Subcellular Location
Nucleus.
Target Protein Families
Metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily
Target Synonyms
Cleavage and polyadenylation specific factor 3 73kDa; Cleavage and polyadenylation specificity factor 73 kDa subunit; Cleavage and polyadenylation specificity factor subunit 3; CPSF 73; CPSF 73 kDa subunit; CPSF; CPSF-73; cpsf3; CPSF3_HUMAN; CPSF73; mRNA 3''-end-processing endonuclease CPSF-73; YSH1
Target Background
This gene encodes a member of the metallo-beta-lactamase family. The encoded protein is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3'-cleavage site AAUAAA prior to polyadenylation. It also cleaves after the pre-mRNA sequence ACCCA during histone 3'-end pre-mRNA processing.
Notification