Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRABP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human CRABP1 (NP_004369.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRABP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human CRABP1 (NP_004369.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03198A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRABP1 |
| Target Synonyms | RBP5; CRABP; CRABPI; CRABP-I; CRABP1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human CRABP1 (NP_004369.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE | Uniprot ID | P29762 |
Uniprot Id
P29762
Target Species
Human
Target Name
CRABP1
Target Full Name
Cellular retinoic acid-binding protein 1
Target Function
Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Research Area
Transport
Target Synonyms
Cellular retinoic acid binding protein 1; Cellular retinoic acid-binding protein 1; Cellular retinoic acid-binding protein I; CRABP 1; CRABP; CRABP I; CRABP-I; Crabp1; CRABPI; RABP1_HUMAN; RBP 5; RBP5; Retinoic acid binding protein I cellular
Target Background
This gene encodes a specific binding protein for a vitamin A family member and is thought to play an important role in retinoic acid-mediated differentiation and proliferation processes. It is structurally similar to the cellular retinol-binding proteins, but binds only retinoic acid at specific sites within the nucleus, which may contribute to vitamin A-directed differentiation in epithelial tissue.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
