Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRABP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CRABP2 (NP_001869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CRABP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CRABP2 (NP_001869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08768A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRABP2 |
| Target Synonyms | RBP6; CRABP-II; CRABP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, 293T, A-431, HT-29, MCF7, Mouse brain, Mouse uterus, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CRABP2 (NP_001869.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKM | Uniprot ID | P29373 |
Uniprot Id
P29373
Target Species
Human
Target Name
CRABP2
Target Full Name
Cellular retinoic acid-binding protein 2
Target Function
Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors.
Target Subcellular Location
Cytoplasm. Endoplasmic reticulum. Nucleus. Note=Upon ligand binding, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Synonyms
Cellular retinoic acid binding protein 2; Cellular retinoic acid binding protein II; Cellular retinoic acid-binding protein 2; Cellular retinoic acid-binding protein II; CRABP II; CRABP-II; Crabp2; CRABPII; RABP2_HUMAN; RBP6; Rretinoic acid-binding protein, cellular, type II
Target Background
This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
