Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRELD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CRELD1 (NP_056328.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CRELD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CRELD1 (NP_056328.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05228A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRELD1 |
| Target Synonyms | AVSD2; CIRRIN; CRELD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CRELD1 (NP_056328.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLKLCCPAGTFGP | Uniprot ID | Q96HD1 |
Uniprot Id
Q96HD1
Target Species
Human
Target Name
CRELD1
Target Full Name
Protein disulfide isomerase CRELD1
Target Function
Protein disulfide isomerase. Promotes the localization of acetylcholine receptors (AChRs) to the plasma membrane.
Target Involvement
Atrioventricular septal defect 2 (AVSD2)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
CRELD family
Target Tissue Specificity
Highly expressed in fetal lung, liver, kidney, adult heart, brain and skeletal muscle. Weakly expressed in placenta, fetal brain, and adult lung, liver, kidney and pancreas.
Target Synonyms
CRELD1; CIRRIN; UNQ188/PRO214; Protein disulfide isomerase CRELD1; Cysteine-rich with EGF-like domain protein 1
Target Background
This gene encodes a member of a subfamily of epidermal growth factor-related proteins. The encoded protein is characterized by a cysteine-rich with epidermal growth factor-like domain. This protein may function as a cell adhesion molecule. Mutations in this gene are the cause of atrioventricular septal defect. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
