-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human CRH (NP_000747.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human CRH (NP_000747.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01750A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRH |
| Target Synonyms | CRF; CRH1; CRH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver, Rat liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human CRH (NP_000747.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII | Uniprot ID | P06850 |
Uniprot Id
P06850
Target Species
Human
Target Name
CRH
Target Full Name
Corticoliberin
Target Function
Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile.
Target Subcellular Location
Secreted.
Target Protein Families
Sauvagine/corticotropin-releasing factor/urotensin I family
Target Tissue Specificity
Produced by the hypothalamus and placenta.
Target Synonyms
CRHCorticoliberin; Corticotropin-releasing factor; CRF; Corticotropin-releasing hormone
Target Background
This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition.
Notification