Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRKL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 201-300 of human CRKL (NP_005198.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRKL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 201-300 of human CRKL (NP_005198.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10385A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRKL |
| Target Synonyms | CRKL | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse brain, Mouse liver, Mouse thymus, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 201-300 of human CRKL (NP_005198.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD | Uniprot ID | P46109 |
Uniprot Id
P46109
Target Species
Human
Target Name
CRKL
Target Full Name
Crk-like protein
Target Function
May mediate the transduction of intracellular signals.
Target Protein Families
CRK family
Target Synonyms
Crk L; Crk like protein; Crk-like protein; Crkl; CRKL_HUMAN; Crkol; HGNC:2363 ; Oncogene CrkL; V crk avian sarcoma virus CT10 oncogene homolog like; v crk sarcoma virus CT10 oncogene homolog (avian) like; V crk sarcoma virus CT10 oncogene homolog avian like
Target Background
This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
