Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRLS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human CRLS1 (NP_061968.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRLS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human CRLS1 (NP_061968.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11011A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRLS1 |
| Target Synonyms | CLS; CLS1; GCD10; COSPD57; C20orf155; dJ967N21.6; CRLS1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human CRLS1 (NP_061968.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIP | Uniprot ID | Q9UJA2 |
Uniprot Id
Q9UJA2
Target Species
Human
Target Name
CRLS1
Target Full Name
Cardiolipin synthase (CMP-forming)
Target Function
Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a key phospholipid in mitochondrial membranes and plays important roles in maintaining the functional integrity and dynamics of mitochondria under both optimal and stress conditions.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Target Tissue Specificity
Highly expressed in tissues such as heart, skeletal muscle and liver.
Target Synonyms
CRLS1; C20orf155; CLS1; Cardiolipin synthase; CMP-forming; CLS; Protein GCD10 homolog
Target Background
This gene encodes a member of the CDP-alcohol phosphatidyltransferase class-I family of proteins. The encoded enzyme catalyzes the synthesis of cardiolipin, a phospholipid component of mitochondrial membranes that is critical for mitochondrial function.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
