Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRMP3/DPYSL4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CRMP3/DPYSL4 (O14531) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRMP3/DPYSL4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CRMP3/DPYSL4 (O14531) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14438A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRMP3/DPYSL4 |
| Target Synonyms | CRMP3; DRP-4; ULIP4; CRMP3/DPYSL4 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CRMP3/DPYSL4 (O14531). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGGVDVHTRLQMPVLGMTPADDFCQGTKAALAGG | Uniprot ID | O14531 |
Uniprot Id
O14531
Target Species
Human
Target Name
DPYSL4
Target Full Name
Dihydropyrimidinase-related protein 4
Target Function
Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family
Target Research Area
Neuroscience
Target Synonyms
Collapsin response mediator protein 3; CRMP 3; CRMP-3; CRMP3; Dihydropyrimidinase like 4; Dihydropyrimidinase related protein 4; Dihydropyrimidinase-related protein 4; DPYL4_HUMAN; DPYSL4; DRP 4; DRP-4; DRP4; ULIP 4; ULIP-4; ULIP4; UNC33 like phosphoprotein 4; UNC33-like phosphoprotein 4
Target Background
Enables filamin binding activity. Predicted to be involved in nervous system development. Predicted to be located in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
