-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRTC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRTC1 (NP_056136.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRTC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRTC1 (NP_056136.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05080A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRTC1 |
| Target Synonyms | MAML2; MECT1; Mam-2; TORC1; TORC-1; WAMTP1; CRTC1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRTC1 (NP_056136.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLS | Uniprot ID | Q6UUV9 |
Uniprot Id
Q6UUV9
Target Species
Human
Target Name
CRTC1
Target Full Name
CREB-regulated transcription coactivator 1
Target Function
Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. In the hippocampus, involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. May be required for dendritic growth of developing cortical neurons. In concert with SIK1, regulates the light-induced entrainment of the circadian clock. In response to light stimulus, coactivates the CREB-mediated transcription of PER1 which plays an important role in the photic entrainment of the circadian clock.; (Microbial infection) Plays a role of coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).
Target Involvement
A chromosomal aberration involving CRTC1 is found in mucoepidermoid carcinomas, benign Warthin tumors and clear cell hidradenomas. Translocation t(11;19)(q21;p13) with MAML2. The fusion protein consists of the N-terminus of CRTC1 joined to the C-terminus of MAML2. The reciprocal fusion protein consisting of the N-terminus of MAML2 joined to the C-terminus of CRTC1 has been detected in a small number of mucoepidermoid carcinomas.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
TORC family
Target Tissue Specificity
Highly expressed in adult and fetal brain. Located to specific regions such as the prefrontal cortex and cerebellum. Very low expression in other tissues such as heart, spleen, lung, skeletal muscle, salivary gland, ovary and kidney.
Target Synonyms
KIAA0616; CREB regulated transcription coactivator 1; CREB-regulated transcription coactivator 1; CRTC1; CRTC1_HUMAN; FLJ14027; MECT 1; Mucoepidermoid carcinoma translocated 1; Mucoepidermoid carcinoma translocated protein 1; TORC-1; TORC1; Transducer of CREB protein 1; Transducer of regulated cAMP response element binding protein 1; Transducer of regulated cAMP response element-binding protein (CREB) 1; Transducer of regulated cAMP response element-binding protein 1; WAMTP1
Target Background
Enables cAMP response element binding protein binding activity. Involved in positive regulation of transcription by RNA polymerase II. Located in cytosol; nuclear body; and plasma membrane.
Notification