-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRYAA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human CRYAA (P02489) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CRYAA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human CRYAA (P02489) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16954A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRYAA |
| Target Synonyms | CRYA1; HSPB4; CTRCT9; CRYAA | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human CRYAA (P02489). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE | Uniprot ID | P02489 |
Uniprot Id
P02489
Target Species
Human
Target Name
CRYAA
Target Full Name
Alpha-crystallin A chain
Target Function
Contributes to the transparency and refractive index of the lens. In its oxidized form (absence of intramolecular disulfide bond), acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions. Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA.
Target Involvement
Cataract 9, multiple types (CTRCT9)
Target Subcellular Location
Cytoplasm. Nucleus. Note=Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles.
Target Protein Families
Small heat shock protein (HSP20) family
Target Tissue Specificity
Expressed in the eye lens (at protein level).
Target Synonyms
Acry 1; Alpha crystallin A chain; Alpha-crystallin A chain; CRYA 1; CRYA1; CRYAA; CRYAA_HUMAN; Crystallin alpha 1; Crystallin alpha A; Heat shock protein beta 4; Heat shock protein beta-4; HSPB 4; HspB4; short form; Zonular Central Nuclear Cataract
Target Background
Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Defects in this gene cause autosomal dominant congenital cataract (ADCC).
Notification