-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRYBA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human CRYBA4 (NP_001877.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRYBA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human CRYBA4 (NP_001877.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05175A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRYBA4 |
| Target Synonyms | CYRBA4; CTRCT23; MCOPCT4; CRYBA4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human CRYBA4 (NP_001877.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETVRSLKVLSGAWVGFEHAGFQGQQYILERGEYPSWDAWGGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWVCSQFPGYRGFQYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQQ | Uniprot ID | P53673 |
Uniprot Id
P53673
Target Species
Human
Target Name
CRYBA4
Target Full Name
Beta-crystallin A4
Target Function
Crystallins are the dominant structural components of the vertebrate eye lens.
Target Involvement
Cataract 23, multiple types (CTRCT23)
Target Protein Families
Beta/gamma-crystallin family
Target Synonyms
Beta A4 crystallin; Beta crystallin A4; Beta-A4 crystallin; Beta-crystallin A4; CRBA4_HUMAN; CRYBA4; Crystallin beta A4; Crystallin; beta polypeptide A4; CTRCT23; Eye lens structural protein; MCOPCT4
Target Background
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta acidic group member, is part of a gene cluster with beta-B1, beta-B2, and beta-B3.
Notification