Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSAD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 371-520 of human CSAD (NP_057073.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CSAD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 371-520 of human CSAD (NP_057073.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05992A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSAD |
| Target Synonyms | CSD; PCAP; CSAD | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 371-520 of human CSAD (NP_057073.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL | Uniprot ID | Q9Y600 |
Uniprot Id
Q9Y600
Target Species
Human
Target Name
CSAD
Target Full Name
Cysteine sulfinic acid decarboxylase
Target Function
Catalyzes the decarboxylation of L-aspartate, 3-sulfino-L-alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. The preferred substrate is 3-sulfino-L-alanine. Does not exhibit any decarboxylation activity toward glutamate.
Target Protein Families
Group II decarboxylase family
Target Tissue Specificity
Expressed in liver and brain. Also expressed in both astrocytes and neurons, but lower levels are expressed in astrocytes.
Target Synonyms
Csad; CSAD_HUMAN; CSD; Cysteine sulfinic acid decarboxylase; Cysteine-sulfinate decarboxylase; Sulfinoalanine decarboxylase
Target Background
This gene encodes a member of the group 2 decarboxylase family. A similar protein in rodents plays a role in multiple biological processes as the rate-limiting enzyme in taurine biosynthesis, catalyzing the decarboxylation of cysteinesulfinate to hypotaurine. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
