-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSDE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CSDE1 (NP_009089.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CSDE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CSDE1 (NP_009089.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14564A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSDE1 |
| Target Synonyms | UNR; D1S155E; CSDE1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CSDE1 (NP_009089.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERM | Uniprot ID | O75534 |
Uniprot Id
O75534
Target Species
Human
Target Name
CSDE1
Target Full Name
Cold shock domain-containing protein E1
Target Function
RNA-binding protein involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Required for efficient formation of stress granules.; (Microbial infection) Required for internal initiation of translation of human rhinovirus RNA.
Target Subcellular Location
Cytoplasm. Cytoplasm, Stress granule. Cytoplasm, P-body.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Cold shock domain containing E1 RNA binding; Cold shock domain containing protein E1; Cold shock domain-containing protein E1; Csde1; CSDE1_HUMAN; D1S155E; DKFZp779B0247; DKFZp779J1455; FLJ26882; N-ras upstream gene protein; NRAS related; Nras upstream gene protein; NRU; Protein UNR; RP5 1000E10.3; UNR; UNR protein; Upstream of NRAS
Target Background
Enables RNA stem-loop binding activity. Involved in IRES-dependent viral translational initiation; nuclear-transcribed mRNA catabolic process, no-go decay; and stress granule assembly. Located in Golgi apparatus; cytosol; and plasma membrane. Part of CRD-mediated mRNA stability complex.
Notification