-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSF3R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 650-750 of human CSF3R (NP_000751.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CSF3R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 650-750 of human CSF3R (NP_000751.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02384A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSF3R |
| Target Synonyms | SCN7; CD114; GCSFR; CSF3R | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CSF3R (NP_000751.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CSPNRKNPLWPSVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDEKKPVPWESHNSSETCGLPTLVQTYVLQGDPRAVSTQPQSQSGTSDQV | Uniprot ID | Q99062 |
Uniprot Id
Q99062
Target Species
Human
Target Name
CSF3R
Target Full Name
Granulocyte colony-stimulating factor receptor
Target Function
Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
Target Involvement
Hereditary neutrophilia (NEUTROPHILIA); Neutropenia, severe congenital 7, autosomal recessive (SCN7)
Target Subcellular Location
[Isoform 2]: Secreted.; Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Type I cytokine receptor family, Type 2 subfamily
Target Tissue Specificity
One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U-937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U-937 cells. Isoform GCSFR-3 is highly e
Target Research Area
Cancer
Target Synonyms
CD 114; CD114; CD114 antigen; Colony stimulating factor 3 receptor (granulocyte); Colony stimulating factor 3 receptor; CSF 3R; CSF3R; CSF3R_HUMAN; Csfgr; G CSF R; G-CSF receptor; G-CSF-R; GCSFR; Granulocyte colony stimulating factor receptor; Granulocyte colony-stimulating factor receptor; OTTHUMP00000009703; OTTHUMP00000009704; OTTHUMP00000009705
Target Background
The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia.
Notification