Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSRP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP1 (NP_004069.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, RIP, ELISA.
The antibody against CSRP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP1 (NP_004069.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, RIP, ELISA.
| Cat.No | ADA-08595A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSRP1 |
| Target Synonyms | CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286; CSRP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, BT-474, Mouse brain, Mouse lung | Application | ELISA, WB, IP, RIP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP1 (NP_004069.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE | Uniprot ID | P21291 |
Uniprot Id
P21291
Target Species
Human
Target Name
CSRP1
Target Full Name
Cysteine and glycine-rich protein 1
Target Function
Could play a role in neuronal development.
Target Subcellular Location
Nucleus.
Target Synonyms
CRP 1; CRP; CRP1; CSRP 1; CSRP; CSRP1; CSRP1_HUMAN; CYRP; Cysteine and glycine rich protein 1; Cysteine and glycine-rich protein 1; Cysteine rich protein 1; Cysteine rich protein; Cysteine-rich protein 1; D1S181E; DKFZp686M148; Epididymis luminal protein 141; Epididymis secretory protein Li 286; HEL 141; HEL S 286; LIM domain protein
Target Background
This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
