-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CST8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 53-142 of human CST8 (NP_005483.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CST8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 53-142 of human CST8 (NP_005483.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02264A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CST8 |
| Target Synonyms | CRES; CTES5; CST8 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 53-142 of human CST8 (NP_005483.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA | Uniprot ID | O60676 |
Uniprot Id
O60676
Target Species
Human
Target Name
CST8
Target Full Name
Cystatin-8
Target Function
Performs a specialized role during sperm development and maturation.
Target Subcellular Location
Secreted.
Target Protein Families
Cystatin family
Target Tissue Specificity
Proximal caput region of the epididymis. Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium.
Target Synonyms
CRES; CST 8; Cst8; CST8_HUMAN; cystatin 8 (cystatin related epididymal specific); Cystatin 8; Cystatin related epididymal specific; Cystatin related epididymal specific protein; Cystatin related epididymal spermatogenic protein; Cystatin related protein epididymis specific; Cystatin-8; Cystatin-related epididymal spermatogenic protein
Target Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The encoded protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing results in multiple transcript variants.
Notification