-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CTP synthase / CTPS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase / CTPS (P17812) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CTP synthase / CTPS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase / CTPS (P17812) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13314A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CTP synthase / CTPS |
| Target Synonyms | CTPS; GATD5; IMD24; GATD5A; CTP synthase / CTPS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase / CTPS (P17812). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS | Uniprot ID | P17812 |
Uniprot Id
P17812
Target Species
Human
Target Name
CTPS1
Target Full Name
CTP synthase 1
Target Function
This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.
Target Involvement
Immunodeficiency 24 (IMD24)
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
CTP synthase family
Target Tissue Specificity
Widely expressed.
Target Research Area
Signal Transduction
Target Synonyms
CTPS1; CTPS; CTP synthase 1; EC 6.3.4.2; CTP synthetase 1; UTP--ammonia ligase 1
Target Background
This gene encodes an enzyme responsible for the catalytic conversion of UTP (uridine triphosphate) to CTP (cytidine triphospate). This reaction is an important step in the biosynthesis of phospholipids and nucleic acids. Activity of this proten is important in the immune system, and loss of function of this gene has been associated with immunodeficiency. Alternative splicing results in multiple transcript variants.
Notification