-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CUEDC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CUEDC2 (NP_076945.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CUEDC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CUEDC2 (NP_076945.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05946A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CUEDC2 |
| Target Synonyms | C10orf66; bA18I14.5; CUEDC2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CUEDC2 (NP_076945.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVD | Uniprot ID | Q9H467 |
Uniprot Id
Q9H467
Target Species
Human
Target Name
CUEDC2
Target Full Name
CUE domain-containing protein 2
Target Function
Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechanism.
Target Involvement
May predict the clinical outcome of tamoxifen therapy of breast cancer patients. Patients with tumors that highly express CUEDC2 do not respond to tamoxifen treatment as effectively as those with tumors with low expression.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
CUEDC2 family
Target Tissue Specificity
Significantly up-regulated in breast tumor tissues compared with matched adjacent normal tissues (at protein level). Levels inversely correlate with ESR1 in breast cancers and are lower in low-grade tumors compared to high-grade tumors.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
bA18I14.5; C10orf66; Chromosome 10 open reading frame 66 ; CUE domain containing 2; CUE domain-containing protein 2; CUED2; CUED2_HUMAN; Cuedc2; MGC2491; OTTHUMP00000020368
Target Background
Predicted to enable ubiquitin binding activity. Acts upstream of or within negative regulation of cytokine production involved in inflammatory response and negative regulation of macrophage cytokine production. Located in cytosol; nuclear membrane; and nucleoplasm.
Notification