Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCL9/MIG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of human CXCL9/MIG( NP_002407.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CXCL9/MIG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of human CXCL9/MIG( NP_002407.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of recombinant Human CXCL9 Protein using CXCL9/MIG Protein Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 5ng/1ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-15713A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCL9/MIG |
| Target Synonyms | CMK; MIG; Humig; SCYB9; crg-10; CXCL9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Recombinant Human CXCL9 Protein | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of human CXCL9/MIG( NP_002407.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT | Uniprot ID | Q07325 |
Uniprot Id
Q07325
Target Species
Human
Target Name
CXCL9
Target Full Name
C-X-C motif chemokine 9
Target Function
Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Research Area
Immunology
Target Synonyms
C-X-C motif chemokine 9; chemokine (C-X-C motif) ligand 9; CMK; crg-10; CXCL9; CXCL9_HUMAN; gamma interferon induced monokine; Gamma-interferon-induced monokine; HuMIG; MIG; monokine induced by gamma interferon; monokine induced by interferon gamma; Monokine induced by interferon-gamma; SCYB9; Small inducible cytokine B9; small inducible cytokine subfamily B member 9; Small-inducible cytokine B9
Target Background
This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
