Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYB5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CYB5A (NP_683725.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CYB5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CYB5A (NP_683725.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03798A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYB5A |
| Target Synonyms | CYB5; MCB5; METAG; CYB5A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, HT-29, M21, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CYB5A (NP_683725.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI | Uniprot ID | P00167 |
Uniprot Id
P00167
Target Species
Human
Target Name
CYB5A
Target Full Name
Cytochrome b5
Target Function
Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.
Target Involvement
Methemoglobinemia CYB5A-related (METHB-CYB5A)
Target Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.; [Isoform 2]: Cytoplasm.
Target Protein Families
Cytochrome b5 family
Target Synonyms
CYB5A; CYB5; Cytochrome b5; Microsomal cytochrome b5 type A; MCB5
Target Background
The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
