Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYB5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-150 of human CYB5B (NP_085056.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CYB5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-150 of human CYB5B (NP_085056.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04755A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYB5B |
| Target Synonyms | OMB5; CYB5-M; CYPB5M; CYB5B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, LO2, Mouse brain, Mouse thymus, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 16-150 of human CYB5B (NP_085056.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS | Uniprot ID | O43169 |
Uniprot Id
O43169
Target Species
Human
Target Name
CYB5B
Target Full Name
Cytochrome b5 type B
Target Function
Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.
Target Subcellular Location
Mitochondrion outer membrane.
Target Protein Families
Cytochrome b5 family
Target Synonyms
CYB5B; CYB5M; OMB5; Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform
Target Background
Enables heme binding activity. Contributes to nitrite reductase (NO-forming) activity. Involved in nitric oxide biosynthetic process. Located in membrane. Part of nitric-oxide synthase complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
