Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYBA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 126-195 of human CYBA (NP_000092.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CYBA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 126-195 of human CYBA (NP_000092.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11727A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYBA |
| Target Synonyms | CGD4; p22-PHOX; CYBA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, RAW264.7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 126-195 of human CYBA (NP_000092.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV | Uniprot ID | P13498 |
Uniprot Id
P13498
Target Species
Human
Target Name
CYBA
Target Full Name
Cytochrome b-245 light chain
Target Function
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide.
Target Involvement
Granulomatous disease, chronic, cytochrome-b-negative, autosomal recessive (ARCGD)
Target Subcellular Location
Cell membrane.
Target Protein Families
P22phox family
Target Synonyms
CYBACytochrome b-245 light chain; Cytochrome b(558) alpha chain; Cytochrome b558 subunit alpha; Neutrophil cytochrome b 22 kDa polypeptide; Superoxide-generating NADPH oxidase light chain subunit; p22 phagocyte B-cytochrome; p22-phox; p22phox
Target Background
Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
