Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (P14635) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against Cyclin B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (P14635) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-16696A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin B1 |
| Target Synonyms | CCNB; Cyclin B1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (P14635). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV | Uniprot ID | P14635 |
Uniprot Id
P14635
Target Species
Human
Target Name
CCNB1
Target Full Name
G2/mitotic-specific cyclin-B1
Target Function
Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Cyclin family, Cyclin AB subfamily
Target Research Area
Cell Biology
Target Synonyms
CCNB 1; CCNB; ccnb1; CCNB1_HUMAN; Cyclin B1; G2 mitotic specific cyclin B1 ; G2/mitotic-specific cyclin-B1
Target Background
The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
