-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin H was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Cyclin H was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16464A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin H |
| Target Synonyms | CAK; p34; p37; CycH; Cyclin H | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, Jurkat, Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL | Uniprot ID | P51946 |
Uniprot Id
P51946
Target Species
Human
Target Name
CCNH
Target Full Name
Cyclin-H
Target Function
Regulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
Target Subcellular Location
Nucleus.
Target Protein Families
Cyclin family, Cyclin C subfamily
Target Synonyms
6330408H09Rik; AI661354; AV102684; AW538719; CAK; CAK complex subunit; ccnh; CCNH_HUMAN; CDK activating kinase; CDK activating kinase complex subunit; Cyclin dependent kinase activating kinase; cyclin dependent kinase activating kinase complex subunit; Cyclin H; Cyclin-H; CyclinH; MO15 associated protein; MO15-associated protein; p34; p36; p37
Target Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.
Notification