-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin T1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 220-320 of human Cyclin T1 (NP_001231.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cyclin T1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 220-320 of human Cyclin T1 (NP_001231.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04417A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin T1 |
| Target Synonyms | CCNT; CYCT1; HIVE1; Cyclin T1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 220-320 of human Cyclin T1 (NP_001231.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESS | Uniprot ID | O60563 |
Uniprot Id
O60563
Target Species
Human
Target Name
CCNT1
Target Full Name
Cyclin-T1
Target Function
Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II).; (Microbial infection) In case of HIV or SIV infections, binds to the transactivation domain of the viral nuclear transcriptional activator, Tat, thereby increasing Tat's affinity for the transactivating response RNA element (TAR RNA). Serves as an essential cofactor for Tat, by promoting RNA Pol II activation, allowing transcription of viral genes.
Target Subcellular Location
Nucleus.
Target Protein Families
Cyclin family, Cyclin C subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Research Area
Cell Biology
Target Synonyms
CCN T1; CCNT; CCNT 1; Ccnt1; CCNT1_HUMAN; CDK9 associated C type protein; Cyc T1; Cyclin C related protein; Cyclin T; cyclin T1; Cyclin T1b; Cyclin-T; Cyclin-T1; CYCT 1; CycT1; HIVE1; Human immunodeficiency virus 1 expression; Human immunodeficiency virus type 1 (HIV 1) expression (elevated) 1; pTEFb subunit; Subunit of positive elongation transcription factor b
Target Background
This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
Notification