Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclophilin B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cyclophilin B (P23284) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cyclophilin B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cyclophilin B (P23284) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13916A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclophilin B |
| Target Synonyms | OI9; CYPB; SCYLP; CYP-S1; HEL-S-39; Cyclophilin B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HepG2, HT-29, Mouse liver, Mouse pancreas, Rat liver, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cyclophilin B (P23284). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIA | Uniprot ID | P23284 |
Uniprot Id
P23284
Target Species
Human
Target Name
PPIB
Target Full Name
Peptidyl-prolyl cis-trans isomerase B
Target Function
PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding.
Target Involvement
Osteogenesis imperfecta 9 (OI9)
Target Subcellular Location
Virion.
Target Protein Families
Cyclophilin-type PPIase family, PPIase B subfamily
Target Synonyms
AA408962; AA553318; AI844835; Cphn 2; Cphn2; Cyclophilin B; Cyclophilin like protein; CyP 20b; CYP S1; CYP-S1; CYPB; EC 5.2.1.8; MGC14109; MGC2224; OI9; peptidyl prolyl cis trans isomerase B; Peptidyl prolyl cis trans isomerase B precursor; Peptidyl-prolyl cis-trans isomerase B; peptidylprolyl isomerase B (cyclophilin B); Peptidylprolyl isomerase B; PPIase; PPIase B; Ppib; PPIB_HUMAN; Rotamase; Rotamase B; S cyclophilin; S-cyclophilin; SCYLP
Target Background
The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
