-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYFIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYFIP1 (Q7L576) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CYFIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYFIP1 (Q7L576) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13377A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYFIP1 |
| Target Synonyms | SHYC; SRA1; SRA-1; P140SRA-1; CYFIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Jurkat, K-562, Mouse lung, Mouse placenta, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYFIP1 (Q7L576). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNE | Uniprot ID | Q7L576 |
Uniprot Id
Q7L576
Target Species
Human
Target Name
CYFIP1
Target Full Name
Cytoplasmic FMR1-interacting protein 1
Target Function
Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. Promotes the translation repression activity of FMR1 in brain probably by mediating its association with EIF4E and mRNA. Regulates formation of membrane ruffles and lamellipodia. Plays a role in axon outgrowth. Binds to F-actin but not to RNA. Part of the WAVE complex that regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1. Regulator of epithelial morphogenesis. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes. May act as an invasion suppressor in cancers.
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Cell projection, lamellipodium. Cell projection, ruffle. Cell junction, synapse, synaptosome.
Target Protein Families
CYFIP family
Target Synonyms
CY; CYFIP 1; CYFIP1; CYFP1_HUMAN; Cytoplasmic FMR1 interacting protein 1; Cytoplasmic FMR1-interacting protein 1; FLJ45151; KIAA0068; p140sra 1; p140sra-1; P140SRA1; Selective hybridizing clone; SHYC; Specifically Rac1 associated protein 1; Specifically Rac1-associated protein 1; SRA 1; Sra-1; SRA1
Target Background
This gene encodes a protein that regulates cytoskeletal dynamics and protein translation. The encoded protein is a component of the WAVE regulatory complex (WRC), which promotes actin polymerization. This protein also interacts with the synaptic functional regulator FMR1 protein and translation initiation factor 4E to inhibit protein translation. A large chromosomal deletion including this gene is associated with increased risk of schizophrenia and epilepsy in human patients. Reduced expression of this gene has been observed in various human cancers and the encoded protein may inhibit tumor invasion.
Notification