-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYP17A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human CYP17A1 (P05093) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CYP17A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human CYP17A1 (P05093) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16798A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYP17A1 |
| Target Synonyms | CPT7; CYP17; S17AH; P450C17; CYP17A1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, PC-3, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human CYP17A1 (P05093). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPW | Uniprot ID | P05093 |
Uniprot Id
P05093
Target Species
Human
Target Name
CYP17A1
Target Full Name
Steroid 17-alpha-hydroxylase/17,20 lyase
Target Function
A cytochrome P450 monooxygenase involved in corticoid and androgen biosynthesis. Catalyzes 17-alpha hydroxylation of C21 steroids, which is common for both pathways. A second oxidative step, required only for androgen synthesis, involves an acyl-carbon cleavage. The 17-alpha hydroxy intermediates, as part of adrenal glucocorticoids biosynthesis pathway, are precursors of cortisol (Probable). Hydroxylates steroid hormones, pregnenolone and progesterone to form 17-alpha hydroxy metabolites, followed by the cleavage of the C17-C20 bond to form C19 steroids, dehydroepiandrosterone (DHEA) and androstenedione. Has 16-alpha hydroxylase activity. Catalyzes 16-alpha hydroxylation of 17-alpha hydroxy pregnenolone, followed by the cleavage of the C17-C20 bond to form 16-alpha-hydroxy DHEA. Also 16-alpha hydroxylates androgens, relevant for estriol synthesis. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Target Involvement
Adrenal hyperplasia 5 (AH5)
Target Subcellular Location
Endoplasmic reticulum membrane. Microsome membrane.
Target Protein Families
Cytochrome P450 family
Target Research Area
Metabolism, Cardiovascular
Target Synonyms
20 lyase; CP17A_HUMAN; CPT7; CYP17; CYP17A1; CYPXVII; Cytochrome P450 17A1; Cytochrome P450 family 17; Cytochrome P450 family 17 subfamily A polypeptide 1; Cytochrome p450 subfamily XVII (steroid 17 alpha hydroxylase) adrenal hyperplasia; Cytochrome p450 XVIIA1; Cytochrome P450-C17; Cytochrome P450c17; OTTHUMP00000020382; P450 C17; P450c17; S17AH; Steroid 17 alpha hydroxylase/17,20 lyase; Steroid 17 alpha monooxygenase; Steroid 17-alpha-hydroxylase/17; Steroid 17-alpha-monooxygenase
Target Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17, 20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17, 20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.
Notification