-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYP1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 205-305 of human CYP1A2 (NP_000752.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CYP1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 205-305 of human CYP1A2 (NP_000752.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12215A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYP1A2 |
| Target Synonyms | CP12; CYPIA2; P3-450; P450(PA); CYP1A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 205-305 of human CYP1A2 (NP_000752.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQE | Uniprot ID | P05177 |
Uniprot Id
P05177
Target Species
Human
Target Name
CYP1A2
Target Full Name
Cytochrome P450 1A2
Target Function
A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta-estradiol (E2), namely 2-hydroxy E1 and E2. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis. May act as a major enzyme for all-trans retinoic acid biosynthesis in the liver. Catalyzes two successive oxidative transformation of all-trans retinol to all-trans retinal and then to the active form all-trans retinoic acid. Primarily catalyzes stereoselective epoxidation of the last double bond of polyunsaturated fatty acids (PUFA), displaying a strong preference for the (R,S) stereoisomer. Catalyzes bisallylic hydroxylation and omega-1 hydroxylation of PUFA. May also participate in eicosanoids metabolism by converting hydroperoxide species into oxo metabolites (lipoxygenase-like reaction, NADPH-independent). Plays a role in the oxidative metabolism of xenobiotics. Catalyzes the N-hydroxylation of heterocyclic amines and the O-deethylation of phenacetin. Metabolizes caffeine via N3-demethylation (Probable).
Target Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Target Protein Families
Cytochrome P450 family
Target Tissue Specificity
Liver.
Target Synonyms
Aryl hydrocarbon hydroxylase; CP 12; CP12; CP1A2_HUMAN; CYP1A2; CYPIA2; Cytochrome P(3)450; Cytochrome P450 1A2; Cytochrome P450 4; Cytochrome P450 family 1 polypeptide 2; Cytochrome P450 family 1 subfamily A polypeptide 2; Cytochrome P450 subfamily I aromatic compound inducible polypeptide 2; Cytochrome P450-P3; Cytochrome P4501A2; Dioxin inducable P3 450; Flavoprotein linked monooxygenase; Flavoprotein-linked monooxygenase; Microsomal monooxygenase; P(3)450; P3 450; P450 4; P450 form 4; P450 P3; P450(PA); Xenobiotic monooxygenase
Target Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region.
Notification