-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYP4X1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human CYP4X1 (NP_828847.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CYP4X1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human CYP4X1 (NP_828847.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07141A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYP4X1 |
| Target Synonyms | CYPIVX1; CYP4X1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human CYP4X1 (NP_828847.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIV | Uniprot ID | Q8N118 |
Uniprot Id
Q8N118
Target Species
Human
Target Name
CYP4X1
Target Full Name
Cytochrome P450 4X1
Target Function
A cytochrome P450 monooxygenase that selectively catalyzes the epoxidation of the last double bond of the arachidonoyl moiety of anandamide, potentially modulating endocannabinoid signaling. Has no hydroxylase activity toward various fatty acids, steroids and prostaglandins. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.
Target Protein Families
Cytochrome P450 family
Target Tissue Specificity
Expressed in brain, heart, kidney and skin and, at lower levels, in skeletal muscle and liver. In the brain, high levels are detected in amygdala and lower levels in globus pallidus and cerebellum. In the heart, very high levels in aorta, but very low lev
Target Synonyms
CYP4X1; UNQ1929/PRO4404; Cytochrome P450 4X1; CYPIVX1
Target Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes and is located within a cluster of genes belonging to this superfamily on chromosome 1. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain. Alternative splicing results in multiple transcript variants.
Notification