-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYR61 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 120-220 of human CYR61 (NP_001545.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CYR61 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 120-220 of human CYR61 (NP_001545.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12751A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYR61 |
| Target Synonyms | GIG1; CYR61; IGFBP10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 120-220 of human CYR61 (NP_001545.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRIL | Uniprot ID | O00622 |
Uniprot Id
O00622
Target Species
Human
Target Name
CCN1
Target Full Name
CCN family member 1
Target Function
Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CCN1-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
Target Subcellular Location
Secreted.
Target Protein Families
CCN family
Target Research Area
Stem Cells
Target Synonyms
3CH61; CCN 1; CCN family member 1; CCN1; CYR 61; Cyr61; CYR61 protein; CYR61_HUMAN; Cysteine rich angiogenic inducer 61; Cysteine rich heparin binding protein 61; Cysteine-rich angiogenic inducer 61; GIG 1; GIG1; IBP-10; IGF-binding protein 10; Igfbp 10; IGFBP-10; Igfbp10; Insulin like growth factor binding protein 10; Insulin-like growth factor-binding protein 10; Protein CYR61; Protein GIG1
Target Background
The secreted protein encoded by this gene is growth factor-inducible and promotes the adhesion of endothelial cells. The encoded protein interacts with several integrins and with heparan sulfate proteoglycan. This protein also plays a role in cell proliferation, differentiation, angiogenesis, apoptosis, and extracellular matrix formation.
Notification