-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cystathionase/CTH was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cystathionase/CTH (P32929) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cystathionase/CTH was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cystathionase/CTH (P32929) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13942A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cystathionase/CTH |
| Target Synonyms | CGL; CSE; Cystathionase/CTH | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cystathionase/CTH (P32929). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHL | Uniprot ID | P32929 |
Uniprot Id
P32929
Target Species
Human
Target Name
CTH
Target Full Name
Cystathionine gamma-lyase
Target Function
Catalyzes the last step in the trans-sulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function.
Target Involvement
Cystathioninuria (CSTNU)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Trans-sulfuration enzymes family
Target Synonyms
CGL_HUMAN; CTH; cystathionase (cystathionine gamma-lyase); Cystathionine gamma lyase; Cystathionine gamma-lyase; Cysteine desulfhydrase; Gamma cystathionase; Gamma-cystathionase; Homoserine deaminase; Homoserine dehydratase; MGC9471
Target Background
This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms.
Notification