-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 19 (CK19) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 19 (KRT19) (KRT19) (P08727) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Cytokeratin 19 (CK19) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 19 (KRT19) (KRT19) (P08727) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16934A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 19 (CK19) |
| Target Synonyms | K19; KRT19; K1CS; Cytokeratin 19 (CK19) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3 cells, MCF7 cells | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 19 (KRT19) (KRT19) (P08727). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGAYGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRA | Uniprot ID | P08727 |
Uniprot Id
P08727
Target Species
Human
Target Name
KRT19
Target Full Name
Keratin, type I cytoskeletal 19
Target Function
Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in a defined zone of basal keratinocytes in the deep outer root sheath of hair follicles. Also observed in sweat gland and mammary gland ductal and secretory cells, bile ducts, gastrointestinal tract, bladder urothelium, oral epithelia, esophagu
Target Research Area
Signal Transduction
Target Synonyms
40 kDa keratin intermediate filament; CK 19; CK-19; CK19; Cytokeratin 19; Cytokeratin-19; K19; K1C19_HUMAN; K1CS; Keratin 19; Keratin type I 40 kD; Keratin type I 40kD; Keratin type I cytoskeletal 19; Keratin, type I cytoskeletal 19; Keratin, type I, 40 kd; Keratin-19; KRT19; MGC15366
Target Background
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.
Notification