Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 5 (KRT5) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (KRT5) (NP_000415.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Cytokeratin 5 (KRT5) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (KRT5) (NP_000415.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-11284A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 5 (KRT5) |
| Target Synonyms | K5; CK5; DDD; DDD1; EBS1; EBS2; EBS2A; EBS2B; EBS2C; EBS2D; EBS2E; EBS2F; KRT5A; Cytokeratin 5 (KRT5) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, PC-3 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (KRT5) (NP_000415.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGG | Uniprot ID | P13647 |
Uniprot Id
P13647
Target Species
Human
Target Name
KRT5
Target Full Name
Keratin, type II cytoskeletal 5
Target Involvement
Epidermolysis bullosa simplex, Dowling-Meara type (DM-EBS); Epidermolysis bullosa simplex, with migratory circinate erythema (EBSMCE); Epidermolysis bullosa simplex, Weber-Cockayne type (WC-EBS); Epidermolysis bullosa simplex, Koebner type (K-EBS); Epidermolysis bullosa simplex, with mottled pigmentation (MP-EBS); Dowling-Degos disease 1 (DDD1)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in corneal epithelium (at protein level).
Target Synonyms
58 kDa cytokeratin; CK-5; CK5; Cytokeratin-5; Cytokeratin5; DDD; DDD1; EBS2; epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types; K2C5_HUMAN; K5; keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types); Keratin 5; Keratin; keratin complex 2, basic, gene 5; keratin, type II cytoskeletal 5; Keratin-5; Keratin5; KRT 5; Krt5; KRT5A; type II cytoskeletal 5; Type-II keratin Kb5
Target Background
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the basal layer of the epidermis with family member KRT14. Mutations in these genes have been associated with a complex of diseases termed epidermolysis bullosa simplex. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
