Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human DAB1 (NP_066566.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DAB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human DAB1 (NP_066566.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09044A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAB1 |
| Target Synonyms | SCA37; DAB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse small intestine, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human DAB1 (NP_066566.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVY | Uniprot ID | O75553 |
Uniprot Id
O75553
Target Species
Human
Target Name
DAB1
Target Full Name
Disabled homolog 1
Target Function
Adapter molecule functioning in neural development. May regulate SIAH1 activity.
Target Involvement
Spinocerebellar ataxia 37 (SCA37)
Target Tissue Specificity
Mainly expressed in brain.
Target Synonyms
Dab 1; Dab reelin signal transducer 1; Dab; reelin signal transducer; homolog 1 (Drosophila); Dab1; DAB1_HUMAN; Disabled homolog 1; Disabled homolog 1 Drosophila; Scm; Scr; Scrambler; Yot; Yotari
Target Background
The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
