-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAP Kinase 1 (DAPK1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human DAP Kinase 1 (DAPK1) (P53355) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DAP Kinase 1 (DAPK1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human DAP Kinase 1 (DAPK1) (P53355) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16001A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAP Kinase 1 (DAPK1) |
| Target Synonyms | DAPK; ROCO3; DAP Kinase 1 (DAPK1) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, OVCAR3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human DAP Kinase 1 (DAPK1) (P53355). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIH | Uniprot ID | P53355 |
Uniprot Id
P53355
Target Species
Human
Target Name
DAPK1
Target Full Name
Death-associated protein kinase 1
Target Function
Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. Phosphorylates TPM1, enhancing stress fiber formation in endothelial cells. Phosphorylates STX1A and significantly decreases its binding to STXBP1. Phosphorylates PRKD1 and regulates JNK signaling by binding and activating PRKD1 under oxidative stress. Phosphorylates BECN1, reducing its interaction with BCL2 and BCL2L1 and promoting the induction of autophagy. Phosphorylates TSC2, disrupting the TSC1-TSC2 complex and stimulating mTORC1 activity in a growth factor-dependent pathway. Phosphorylates RPS6, MYL9 and DAPK3. Acts as a signaling amplifier of NMDA receptors at extrasynaptic sites for mediating brain damage in stroke. Cerebral ischemia recruits DAPK1 into the NMDA receptor complex and it phosphorylates GRINB at Ser-1303 inducing injurious Ca(2+) influx through NMDA receptor channels, resulting in an irreversible neuronal death. Required together with DAPK3 for phosphorylation of RPL13A upon interferon-gamma activation which is causing RPL13A involvement in transcript-selective translation inhibition.; Isoform 2 cannot induce apoptosis but can induce membrane blebbing.
Target Subcellular Location
[Isoform 1]: Cytoplasm. Cytoplasm, cytoskeleton. Note=Colocalizes with MAP1B in the microtubules and cortical actin fibers.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily
Target Tissue Specificity
Isoform 2 is expressed in normal intestinal tissue as well as in colorectal carcinomas.
Target Synonyms
DAK1; DAP K1; DAP kinase 1; DAPK 1; DAPK; DAPK1; DAPK1_HUMAN; Death Associated Protein Kinase 1; Death-associated protein kinase 1; DKFZp781I035
Target Background
Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate. Alternative splicing results in multiple transcript variants.
Notification