-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAPK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAPK2 (NP_055141.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DAPK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAPK2 (NP_055141.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08668A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAPK2 |
| Target Synonyms | DRP1; DRP-1; DAPK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAPK2 (NP_055141.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVV | Uniprot ID | Q9UIK4 |
Uniprot Id
Q9UIK4
Target Species
Human
Target Name
DAPK2
Target Full Name
Death-associated protein kinase 2
Target Function
Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell death signals, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Acts as a mediator of anoikis and a suppressor of beta-catenin-dependent anchorage-independent growth of malignant epithelial cells. May play a role in granulocytic maturation. Regulates granulocytic motility by controlling cell spreading and polarization.; Isoform 2 is not regulated by calmodulin. It can phosphorylate MYL9. It can induce membrane blebbing and autophagic cell death.
Target Subcellular Location
Cytoplasm. Cytoplasmic vesicle, autophagosome lumen.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily
Target Tissue Specificity
Expressed in neutrophils and eosinophils. Isoform 2 is expressed in embryonic stem cells (at protein level). Isoform 1 is ubiquitously expressed in all tissue types examined with high levels in heart, lung and skeletal muscle.
Target Synonyms
DAK2; DAP kinase 2; DAP kinase related protein 1; DAP kinase related protein 1 beta isoform; DAP-kinase-related protein 1; DAPK2; DAPK2_HUMAN; Death associated protein kinase 2; Death-associated protein kinase 2; DRP 1; DRP-1; DRP1; MGC119312
Target Background
This gene encodes a protein that belongs to the serine/threonine protein kinase family. This protein contains a N-terminal protein kinase domain followed by a conserved calmodulin-binding domain with significant similarity to that of death-associated protein kinase 1 (DAPK1), a positive regulator of programmed cell death. Overexpression of this gene was shown to induce cell apoptosis. It uses multiple polyadenylation sites.
Notification